DPCstruct | MC18365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 268 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847XW60 | 681-780 | YASVRTGDRMIPCRAEAAGGFIDVTCMNDSDGELVVQENQWTGWTAFIDGHPAGLQPGKFLTVSAPAGKHVYQFRYQPWDVWVGLGL… |
| A0A7C5ZP22 | 35-147 | ASYFGKDIKKAKVKIEKKGSNYIDIFYETDGFSLIVFNDLYYRGWKAIKDNHELPIIKVNEIVKGVFVEKGKGRIRFIYQPFPLFLL… |
| A0A2D6IP26 | 639-741 | None |
| A0A800JE66 | 39-153 | None |
| A0A6J7VVH6 | 34-134 | None |
| A0A6J7UVB0 | 180-316 | None |
| A0A7Y3PJZ4 | 49-168 | None |
| A0A448AJJ3 | 57-163 | None |
| A0A7W0A036 | 2-100 | None |
| A0A848UJD2 | 60-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.