DPCstruct | MC18364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7094 |
|---|---|
| Mean domain length (aa) | 107 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.20 |
| Pfam Score | 77.52 |
| Assigned Pfam label(s) | CL0110- PF09912- CL0203- CL0692- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2JIK4 | 94-176 | EQVHRGVKGFVRDLQGNPIFNASVSVEGIDHDMTTAKDGDYWRLLAPGNYKVGASAPGYLTVIKKVAVSYSPATRVDFELESL |
| A0A7C5YKB2 | 17-116 | FGCLGFNNGKLTPGIFGQVISKGTRQPIANATVSLRRDGNELASVQTNGDGRFAFPNLEPGTYLLVVSANGYWDAQVWVTLAQGQRL… |
| A0A519NIL3 | 834-931 | None |
| A0A662TXP5 | 125-228 | None |
| A0A655U4M1 | 234-310 | None |
| A0A0R2FXA3 | 818-943 | None |
| A0A534N6K4 | 1-90 | None |
| A0A7W1C1F0 | 96-211 | None |
| A0A7C2BKX9 | 167-295 | None |
| A0A517TY43 | 283-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.