DPCstruct | MC18362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 157 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834M6B2 | 38-197 | IPILVSAAFLQMEPLLHDCLLYCHQHMNEILRTATNLNCLNDSVLTRLAAMYTNTEVESIKDRKDKIQSRLFAKLIQSLAEPDPESV… |
| A0A4W5RF80 | 1-150 | MDTLVEECIQYCHKHMSAIVATPCNMNCINSNLAAHISDLFSHNEADDVMDRKDKFKSKLFQKKIECLFNPDYKNQDSPGNASTLYR… |
| A0A4Y2MTT5 | 27-184 | None |
| A0A6A5CFF5 | 199-327 | None |
| A0A812JPC2 | 16-171 | None |
| A0A672KCF6 | 120-282 | None |
| A0A7I8VY82 | 210-370 | None |
| U4UF21 | 274-433 | None |
| A0A6J3C0S6 | 329-488 | None |
| L9KK55 | 118-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.