DPCstruct | MC18361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 64.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.06 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF04795- PF11669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3GM88 | 2-124 | LVIILAFHTAKELCFGVNEQPYWCETGYCCGETECCTYYYELWWFWLVWTIILMLSCCCAYRHRRVKLRLQQEQRQREISLMAYQGA… |
| A0A4W5RD05 | 48-177 | ERIDETMALLLEITQSRLVCHGDNNQSYVCESDHCCGESQCCSYYYELWWFWLVWTLIIILMCCCVSQHRRYKQSFQQQRRQNEINL… |
| H2YXC5 | 2-135 | None |
| A0A6P6K2E4 | 1-144 | None |
| A0A1S3N376 | 12-137 | None |
| A0A3Q2GRC0 | 16-154 | None |
| A0A0N8JXV8 | 89-224 | None |
| A0A7J7U6Y3 | 15-151 | None |
| A0A7J8E2B1 | 162-300 | None |
| G3UBV8 | 18-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.