DPCstruct | MC18360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5RCU6 | 1-94 | MADRSQHEELTELPDLSGFLREDPYLAPYQEDLCRRYQLFTERLSKLQEAEGSFDAFTRSYMSYGVQRQADNSLMFREWAPGAQALF… |
| A0A2R7W8Z1 | 8-94 | LDPMEVEVPELQNLLERDPYLKPYEREFRRRYAVMMDSLERIENDFGGYAKFLSSYRTYGIHVKSDNSVECAEWAPGAIQLYLTGEF |
| A0A813A882 | 4-75 | None |
| A0A2J7ZY55 | 130-217 | None |
| A0A811VCW5 | 5-88 | None |
| L1I501 | 21-108 | None |
| A0A453BXI9 | 83-184 | None |
| A0A2P4Z9T7 | 1-92 | None |
| A0A1Z5SL44 | 12-90 | None |
| A0A5B7DF27 | 8-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.