DPCstruct | MC1836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 380 |
|---|---|
| Mean domain length (aa) | 280 ± 59 aa |
| Standard deviation of domain lengths | 58.63 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.22 |
| Pfam Score | 71.20 |
| Assigned Pfam label(s) | CL0023- PF09524- CL0123- CL0494- PF17948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345YJI5 | 57-324 | KAATRASASPQARLLLVHLIGYLGMDQAENPKVRFVAFPGNQRLADELGYSKRSIQRLADELEAKGLLRRCYNGINRRTAFDLTPLA… |
| K8E094 | 9-270 | ETGFFIGDNAIFDRQDLSAYEKLVYIYLCRRADSESRAWPSYARIAKECGVSRDTAMRAVSKLVEKGLLEKNVRKDPNGNMASNEYI… |
| S2YJ14 | 7-222 | None |
| A0A7C1Q9W0 | 11-216 | None |
| A0A351RVT8 | 2-273 | None |
| A0A2N2VZ10 | 2-202 | None |
| A0A1Y0CIQ1 | 1-275 | None |
| A0A554V927 | 27-314 | None |
| A0A6G2BDL0 | 8-326 | None |
| A0A5C7NLC7 | 9-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.