DPCstruct | MC18355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 61.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 54.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5PEA1 | 1-124 | RFYCKSGRWQHRARDDISKWSLAMGLGDHDLLTCGQCQMNFPLGDILLFIEHKKKQCQTLLQGPGCYDKMQQQNQGRHVHSQLRKVV… |
| A0A4W5R029 | 1-123 | MRKRERVEGLRACSVVSLSLCHLAMGLVDHDLLTCGQCQMNFPLGDILLFIEHKKKQCQTLLQGHGCYDKMAQQQNQGRHGHCQLRK… |
| A0A673K7Z8 | 20-123 | None |
| A0A2D4PMQ6 | 34-143 | None |
| A0A3B3UCU7 | 1-104 | None |
| A0A3N0Y629 | 26-131 | None |
| A0A673ZS63 | 1-102 | None |
| A0A673U0A9 | 30-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.