DPCstruct | MC18354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | CL0396- CL0416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DQ10 | 127-260 | VNCWETKVGNELYRLVLIDFIFILGATFFLEFIHKIMANYCCTKALKEPEFDIGRNTLDLIYSQSLCWFGTFYSPLLSVMMIVKLFI… |
| A0A4W5QVW8 | 1-141 | MSILGILCYYWMKDVANTFSCWESIVGQALYRLVIVDFLFIMLGSFFGEFLSNVIGTKCIQSLGVPEFDVARNVLDLIYAQTLAWIG… |
| A0A7R9IUX9 | 388-541 | None |
| A0A0V0ZB63 | 233-378 | None |
| A0A1S3J8Q4 | 75-222 | None |
| A0A482VU33 | 258-409 | None |
| A0A7R8X135 | 351-536 | None |
| A0A7J6D873 | 182-338 | None |
| A0A2T7PUD8 | 65-225 | None |
| A0A5E4AFM1 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.