DPCstruct | MC18352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 298 ± 33 aa |
| Standard deviation of domain lengths | 33.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7P4Z2 | 218-457 | LLIQVTGAVTASNLPEYKAHALEVFKGINRTLSTDQDFATAESTVKWCADVESRLAAAKEHALSQTATIDELFRTIDDISAEARRTR… |
| E6KYF0 | 1-303 | MKMTTEFNLVLTTESKVLSTNIVEFEKQAEQFLATLTSKFETDDDFAAAKEEVKTLKEVEDKIRAAIKSAQSGEIAALITSAENIAE… |
| A0A2V3XZH8 | 70-405 | None |
| A0A660UXR3 | 1-285 | None |
| A0A1F4JLL7 | 225-557 | None |
| A0A377I8H5 | 1-311 | None |
| A0A1V6FYK9 | 140-459 | None |
| A0A1G9SMK4 | 111-416 | None |
| A0A375ABT7 | 186-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.