DPCstruct | MC1835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 21 aa |
| Standard deviation of domain lengths | 21.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 12.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210QYI4 | 1-84 | MVKLHTASEMVKLHTASEMVKLHTASEMVKLHTASEMVKLQTASETVKLHTTSEILKLHTASEMVKLHIASEMVKLHTASEILK |
| A0A0D3B197 | 1-134 | MLIWAQPKRFSAGKLDLPVSAEKLDLPVSAEKLDLPVSAEKLDLPVSAEKLDLPVSAEKLDLPVSAEKLDLPVSAEKLDLPVSAEKL… |
| A0A8B6GRM3 | 1-113 | None |
| A0A4Y2RP15 | 1-97 | None |
| A0A5M8PQC2 | 5-122 | None |
| A0A803SM15 | 27-140 | None |
| A0A6J8D0H7 | 3-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.