DPCstruct | MC18349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 296 ± 37 aa |
| Standard deviation of domain lengths | 36.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0BKN3 | 98-393 | DIVILKTNNKLEIKYKNEENILLQNYNIYRKTIDYLNGNPLFASIPTTTNEFLLITKEFGFIHIGYNLHEDRTKDFETLKQDFERLK… |
| A0A7A3AB67 | 27-324 | LPPDAIAPWILETCSEKTDEAIKIWKLLGCRELLKCFANELFFADEMMVGLAGKPPRKIAFGDETAALPAFDIIQEAAKWIFLEGNE… |
| A0A848NBE7 | 42-340 | None |
| A0A7W3CT42 | 28-295 | None |
| F9RQS0 | 114-409 | None |
| A0A2A2FCG2 | 21-379 | None |
| A0A4R6X8D5 | 115-417 | None |
| A0A442VL82 | 99-391 | None |
| A0A136QHU1 | 8-302 | None |
| A0A5Q2UEP9 | 37-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.