DPCstruct | MC18348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0VLY8 | 88-197 | HQATGRDLNLVVGQKHNATVGGDMHERIQGLRESITSKSQRLQAPKNWVGSGGVNIFQVVCDLLDLVQDMNTQLAAHTHGPTPVPGN… |
| A0A7A2GME9 | 17-125 | MMVVAGTCERDVEGDTLDTVGGSLTEKIKGVRHSIALAQKLVGDTVKLGNEGINVLTMLTDLADVVEELADITASHTHPKTGTSPQA… |
| A0A328TTP5 | 1-110 | None |
| A0A7D6WWQ0 | 136-246 | None |
| A0A612YIK2 | 137-254 | None |
| A6VSS0 | 256-364 | None |
| A0A291U2U7 | 1-95 | None |
| A0A0A1HY09 | 166-275 | None |
| A0A2T3KJ31 | 146-243 | None |
| W3VAN4 | 88-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.