DPCstruct | MC1834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 54.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7MNX5 | 21-109 | QLPSYQLKDHGAIRECPNCHHLIDNSDVSFEWPGLPAGVKFDPSDAELLEHLSGKIGLGNSEPHLFIEDFIPTLEGEDGICYKHPEN… |
| A0A1U8G0X6 | 25-109 | LQIKDCGAKRQCPNCHYCIDNNDVSPEWPGLPVGVKFDPSDAELVEHLQAKCGMENSEQHKFIDEFIPTLDVYEGICYTHPEKLP |
| A0A835RUP2 | 80-166 | None |
| A0A072TZ22 | 19-109 | None |
| A0A453F7M5 | 14-107 | None |
| A0A453C7G3 | 53-133 | None |
| A0A1R3I171 | 27-133 | None |
| A0A0K9QUK3 | 24-131 | None |
| A0A453C7J1 | 42-110 | None |
| Q0DK52 | 9-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.