DPCstruct | MC18337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 260 ± 45 aa |
| Standard deviation of domain lengths | 45.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 80.23 |
| Assigned Pfam label(s) | CL0020- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8AQ27 | 2-159 | LLLMKAACLERLMELNTLGPADSLTRFLEAQFVINAAHLDSIYDAIGRATTAQVRRNFEAIYAAGVDEYYPGVTGDLIEQLHTALGS… |
| E1TJ96 | 338-604 | FDAALALALQAAASPESEEEQQRVARMLPRLRRKLGEPAVRVRAERAAERSTLILPRPQASASQYAPSPEATHAPPSVEYLVRDHLT… |
| A0A0R3UE86 | 48-438 | None |
| A0A2G8LPJ1 | 409-680 | None |
| R9PLR4 | 679-903 | None |
| A0A158R4T1 | 625-914 | None |
| A0A349X2E2 | 17-206 | None |
| B7Q630 | 239-535 | None |
| A0A4R1PLJ1 | 117-343 | None |
| A0A094JEZ8 | 14-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.