DPCstruct | MC18335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6E1K6 | 1-81 | MLIPINIAKWMWGWPNRFLDRMQAVDTQIHLLGPYSGGGFSEGLDDPQLIDQLPDGYSGGISTDALDLVMPVIKARFGTRP |
| A0A1V2AD34 | 17-96 | PSPCRSRVVYIPINMAPDMWGWPYLLLDRFRGAGSEIFIIGPYHGGNYSNGVDTIADLKSLPDDWSGGLMTNELELLAPA |
| A0A6G3Z395 | 11-84 | None |
| A0A1C4VNP2 | 38-116 | None |
| A0A2T6KAY7 | 125-204 | None |
| A0A0L8C5G6 | 27-93 | None |
| A0A3Q9B881 | 1-67 | None |
| A0A348AR02 | 135-215 | None |
| A0A7X8JU85 | 74-143 | None |
| A0A7V7QMI3 | 21-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.