DPCstruct | MC18333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9B387 | 2-116 | ASAAKSLFQTLRRCIKKPWEYTGPVAHPEYQHSIPKATEYRVYCPSTVPGKAIVPNSLPETVYDIKYFSRDQRRNRPPIKHTFLKKA… |
| A0A843THW6 | 1-122 | MASGKSLLQSLRRFLKKPWEITGPQSHPEYRSSVPGALEYRHHCPATPPVKPIIPTSNPETVFDIKYYTRDQRRNRPPIRRTVLRKA… |
| A0A5N6NHQ2 | 1-125 | None |
| A0A4S4DQA5 | 1-116 | None |
| A0A059A5K4 | 2-113 | None |
| A0A6P4P4A8 | 116-230 | None |
| A0A5D2D4Q1 | 16-157 | None |
| A0A1D6GB06 | 9-128 | None |
| V4T1G1 | 55-170 | None |
| A0A453FKK1 | 85-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.