DPCstruct | MC18332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 206 ± 25 aa |
| Standard deviation of domain lengths | 25.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF18578- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9B2C7 | 1-194 | MIPLSYLEKRQCPSPPLNPSSPPPSSPTSTSPSPPSLHKSPPKPLSNYNQRQPPQQEVYQPYRPPPSPLPARYRNLDTMARLDILAN… |
| A0A6J0JWY3 | 1-207 | MVSLTATILKSSLFSPFTQSTTHGFPTNPITRRRHVTLPITANVSRKPQNMIPKNPPARQNLYQPFRPPSSPVPPQFRSLDSAGKIE… |
| A0A7R9TMP8 | 319-516 | None |
| A0A7J7H6I5 | 1-196 | None |
| A0A4Y7IWW2 | 179-400 | None |
| A0A7J7QED6 | 46-234 | None |
| K8EPM5 | 123-331 | None |
| A0A5N5HMS0 | 2-166 | None |
| A0A822XIN0 | 5-205 | None |
| A0A0D3HE66 | 2-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.