DPCstruct | MC18331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9AYY9 | 1-85 | MARQIATAYGPCGNNRDYLFLLEKAMFNIGHEDDYVIELANEVRKVLLSLSGLSSPLKMKASTGAIGLDSTLKMKVLGGAITMDS |
| A0A0K9PR54 | 44-127 | LGEMATQIATAIGPRGNNREYLLNLEKAMFRIGHDEDSITELANEVRKVMVRFKEKKMIGAHLALNSHLSPVPHILNTSETIVT |
| A0A6S7MY85 | 2-85 | None |
| A0A804QRK2 | 296-381 | None |
| A0A2J6M970 | 24-110 | None |
| A0A6A4PQG4 | 2-95 | None |
| A0A3L6DJZ7 | 2-75 | None |
| A0A445MMH7 | 162-237 | None |
| A0A446W1T3 | 67-146 | None |
| A0A4P1QYL3 | 57-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.