DPCstruct | MC18330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0517 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M8AQU8 | 104-173 | MNQYVLLTLYAFHVYLALELVLASAAAAARALLGMDLEPQFDRPYLSASLRDFWGRRWNLSVPAVLRPCV |
| A0A5P1ECE5 | 122-190 | IHPWAVLALYSLYTYLILDLILSITKFSVGTLLGLTLEPQANDPFKSDSLQDFWGRRWNLMVTGILRPS |
| B9SSQ3 | 151-219 | None |
| A0A445AY27 | 1-71 | None |
| A0A4S4DWW5 | 163-232 | None |
| A0A7J0ED14 | 150-219 | None |
| A0A7J7HA29 | 143-211 | None |
| A0A6A1WPA4 | 11-80 | None |
| A0A7G2FGE8 | 28-109 | None |
| A0A0S3SEK3 | 2-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.