DPCstruct | MC18326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4JTY5 | 81-151 | PSGLKWIEAKWPGTAGTALSNEKLSKALESQIQFTDDEYKKFGIRKLQKDHYIMSGNKYFQPDAGPDPKPG |
| A0A7S3EQY3 | 393-455 | LALGLRWKDAGTTRPSKGKEVSNEKLLAALKQKTAFTREEWDELGVKHLKVDSFAKIGNQYWI |
| A0A7S3AYP9 | 158-229 | None |
| A0A0M0K705 | 11-77 | None |
| A0A0M0JZI6 | 617-681 | None |
| A0A7S4I851 | 8-86 | None |
| A0A0M0J644 | 492-554 | None |
| A0A7S4MVJ0 | 1-82 | None |
| A0A0M0JQ39 | 114-191 | None |
| A0A7S4HD65 | 38-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.