DPCstruct | MC18321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2H504 | 1-103 | PDLETMKSEWATYKKEDDEKPATDEACIRFQAGYVKRLVSYTDYPTFNIDGVIECFLEWEHNKHENIMTFRDKPHKSLMTGHMAPVH… |
| L7LLQ9 | 125-226 | PSAAERAAHMRQWADRYRGVEDDAAAVRFQADYIRDLIEQTDYPMFDLDEVVRIFLEWKADKKRNILTYRDQVYPSVMTGTMAAVHH… |
| A0A815QE06 | 18-92 | None |
| A0A815A9I8 | 204-272 | None |
| A9V7N9 | 331-451 | None |
| A0A4Y4BWZ3 | 175-276 | None |
| A0A7I9VSZ9 | 4-79 | None |
| A0A7X6Q676 | 2-75 | None |
| A0A822CHV1 | 3-127 | None |
| A0A553PCJ2 | 551-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.