DPCstruct | MC18318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2G7F8 | 3-102 | LAADMLVYATGYASMHEFVRGVVGDDSAEAVGPVWGYGSGTAKDPGPYLGELRNMWKPTRVPGLWFMGGNLAQARHYSRLVALQLAA… |
| A0A4Q3HLZ7 | 23-108 | IDADLIVLATGYRKQEEMVERMLGKDVAERVGTIWGYGEKQELRNMYARTAQPGLWFIAGGLAQCRINSKYLGLQIKACELGLIEA |
| A0A2K0UVA8 | 3-78 | None |
| A0A3R7G1D9 | 490-595 | None |
| A0A1L9VCW1 | 25-153 | None |
| A0A4Q7JNJ5 | 806-907 | None |
| A0A4R7KXZ3 | 127-217 | None |
| A0A6A5XGD4 | 87-200 | None |
| A0A0C9VHW8 | 47-142 | None |
| A0A4Y9Z1E5 | 477-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.