DPCstruct | MC18317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 466 ± 66 aa |
| Standard deviation of domain lengths | 66.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0433- CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZIE1 | 38-410 | AEPQGELEVFRGRELAPRDPPREVQPVAPNSRSYVQLCISFILVMLNVIVNMLWPVKFLRMDEQLRVQHLTTVTVVNGPGLVCINPF… |
| A0A7S2G3R4 | 19-434 | GHKTVRAGDRAAVWSKNGAFKIIDGPKRVTLVCQKIEMLRQYTADQTQYIQIRKCSGSVEVHPGPCAIFFTPVEDASIEVKNATMID… |
| S9V8K2 | 1-630 | None |
| A0A2K5QMS6 | 89-594 | None |
| A0A818X997 | 104-507 | None |
| A0A267FM30 | 120-600 | None |
| A0A813FVX3 | 97-495 | None |
| F0YA32 | 373-857 | None |
| A0A8B6EDI4 | 672-1079 | None |
| A0A060XRA4 | 38-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.