DPCstruct | MC18312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.97 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF11338- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S9MY66 | 4-111 | YNKEEVWDEFKEKQNMTHNELEKWLETEESKNAGREMDNGETVGHASGRSILKIKEKNKSDLTEANWDKINETVGYYHQNLHESQKP… |
| A0A1B9FRM9 | 6-136 | DQDVVNDFNEIVNMTADELEAFLKTEGSETTGFQKEDGSGESIGHESGRKIVDILKRNPDKDPSKYTEEDKEHMRRVVSYCKRHLAQ… |
| A0A2T2RLK0 | 458-561 | None |
| A0A2D8XAJ3 | 47-152 | None |
| A0A4R0RPR8 | 5-126 | None |
| A0A2P6NSD1 | 495-604 | None |
| A0A4P7UD37 | 16-118 | None |
| A0A2A2K644 | 5-104 | None |
| A0A2S7QVV9 | 117-225 | None |
| A0A1I4CTC5 | 5-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.