DPCstruct | MC1831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6EID3 | 47-130 | FNVKQYAVSYVPMRALNTSGNDCGAYSLKFIECHLLGLDFSLVNDENIQEARHKIAFDLWEAANDEALQYRMSTFKPPKRAPEK |
| A0A0D3AQW3 | 1-69 | MSGLNRLQCHCGVYTIKHIECHVLGLDISMVSDENIWGARIKIMWDLWEAANDLELIERMSKYEPVKCS |
| A0A3P6DKT4 | 170-253 | None |
| A0A816Q2E8 | 279-365 | None |
| V4L2L5 | 48-124 | None |
| V4KGF7 | 51-141 | None |
| A0A816IAR8 | 1-70 | None |
| A0A3P6E9C6 | 274-362 | None |
| A0A3P6E8P2 | 107-177 | None |
| A0A0D2ZYS6 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.