DPCstruct | MC18307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 237 ± 25 aa |
| Standard deviation of domain lengths | 25.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A450XSF8 | 25-312 | SVPLNHCDRLLEQELQSVYNVESLDQYRDILREVLNHSHDVLQSHVDDAGGGPVGAPLAIATDILLAENANAETRRRLDELRARYSI… |
| A0A243F2L5 | 10-238 | CHSILIHSKANVLIVNENKDMRENILTWIETTSYEEFKRQRENGLGIDVIIPIGLNNNTSKEDYERLQNYIKEGKVIQFSHSEASHI… |
| A0A7W7NZT5 | 14-261 | None |
| A0A158CJ04 | 80-337 | None |
| A0A4R2XXD0 | 16-243 | None |
| A0A7W5HHT9 | 25-237 | None |
| A0A011QJE1 | 4-262 | None |
| A0A6H0A0F2 | 4-253 | None |
| A0A6M1LY52 | 15-229 | None |
| A0A1B1U9H6 | 1-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.