DPCstruct | MC18306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A450XGQ0 | 45-145 | ALTAVIGGMALLGGFNAIFMGDATNTYCISCHEMRNEGIYEEYLKSSHYKNRNGVRATCSDCHVPKEWFPRLIRKIQASSELYHHLA… |
| W7PX07 | 8-109 | AMIFFVAGILFWGGFNTVMEATNSMKFCSSACHEMTWVYEEYKDRPHYKNPTGVGATCSDCHVPDDWGPKMIRKIEASREVWHWMLG… |
| A0A1G8RC87 | 28-126 | None |
| A0A2S9RS43 | 22-111 | None |
| A0A3A1VPA7 | 25-129 | None |
| A0A0F7K0F3 | 23-129 | None |
| A0A182D0X3 | 14-121 | None |
| G5R7N3 | 20-119 | None |
| A0A450WLZ1 | 11-102 | None |
| A0A2X1ND05 | 4-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.