DPCstruct | MC18302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1039 |
|---|---|
| Mean domain length (aa) | 143 ± 28 aa |
| Standard deviation of domain lengths | 27.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 96.83 |
| Assigned Pfam label(s) | PF08628- PF02204- PF03700- PF00787- PF04366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1QI75 | 23-148 | ITLQNNSNEQLFASDSVWCANCTIAEPTIIQGINGGKYALWTIEFETVRGARFKIRKRYNDFDELRNKLEKYTGKTELPKFPPRSGL… |
| A0A7S4V3T4 | 104-213 | AKLHLEACQHSEVDGHTWYRVHCHLVHSMTIGRHWQVDRRLVHLRTSLHDPVKRELGQHYSLFFGSSPFAQYGGPKGTTRRLHVWLQ… |
| A0A5N5TL57 | 113-288 | None |
| A0A194V3Y4 | 36-177 | None |
| K8EQ31 | 376-510 | None |
| A0A7S2SVW6 | 14-190 | None |
| A0A7S2RPC7 | 46-203 | None |
| A0A1S8VVF7 | 1160-1268 | None |
| A0A0P1ATZ3 | 46-218 | None |
| A0A7R9KVE2 | 11-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.