DPCstruct | MC1830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 235 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061FCK0 | 227-491 | KLVFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVDSNLYLQPSTSVVLDAHKEGLEVFASDFTNDVPFSFNYSY… |
| A0A0D3ANF7 | 35-256 | KRWLGMMAQNFLGKEDFELTTKRTYGSILSNLTYVKTFASGILIPKSYILPLDDKQYLLPPTSLVQDAHKAGLQVYVSGFSNDVNIA… |
| A0A453RJ90 | 37-310 | None |
| A0A2Z6N5R9 | 10-180 | None |
| A0A446L6T3 | 157-397 | None |
| A0A3L6RHW8 | 39-275 | None |
| A0A2C9VMN3 | 1-235 | None |
| A0A446XC54 | 127-388 | None |
| B8BPI0 | 39-255 | None |
| A0A6A2WAK2 | 142-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.