DPCstruct | MC183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 296 ± 30 aa |
| Standard deviation of domain lengths | 29.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815RFV3 | 20-319 | IDRLITFLFHLFFQKKFLVHRLVGLLYLIQYALCFYWYCKNYETFKESFLIWSLPLTGLIQSIIATLTFTFLSRTKIDPGYYSDRGT… |
| A0A6C0BWX3 | 77-390 | SILDFLKSKFNASPLRKLFTKEDKANMHKILGVVSLLVYAWYYFGVIKNGSTYGIPRGRTTLDVVLSMLPAALLSISSLQFNLANNF… |
| A0A7S3AYU5 | 48-350 | None |
| A0A7S1W5P5 | 16-310 | None |
| A0A7S2MYD7 | 31-331 | None |
| A0A7S4URW9 | 60-360 | None |
| A0A0M0LS67 | 3-281 | None |
| A0A6C0LFP7 | 6-254 | None |
| A0A830HXL7 | 2-247 | None |
| A0A7S4NIV0 | 20-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.