DPCstruct | MC18299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 181 ± 44 aa |
| Standard deviation of domain lengths | 43.89 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KM77 | 2-129 | EPERKPLSLLELCFRSAVDNLRYMNSVDNLEMGLLKRILPHCTLEQLTHIESCTEMDLTGVTDVLWKRFFQREFGEADMNVAIKRMK… |
| W1Q951 | 11-161 | KGPLSLTQLARIKCIQNAHLINDIGQAPYHLVEPILKKKTAKALRVIEEQSPQIVAHDDPLWQCLIQRDFSERPCEQITIKNGRKTK… |
| A0A0C9TZ85 | 1-208 | None |
| A0A540KHA9 | 1-175 | None |
| R9PP62 | 37-230 | None |
| A0A6I8PH67 | 945-1144 | None |
| G4TC11 | 1-216 | None |
| A0A6I9PHJ7 | 3-150 | None |
| S4RJB0 | 190-317 | None |
| A0A811LPJ5 | 199-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.