DPCstruct | MC18298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 301 ± 44 aa |
| Standard deviation of domain lengths | 44.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2IHD0 | 8-396 | EMIAASVFGAVLYTIIGIAPGTDETAVLAPVTLVLVLTGMEPIVILAFFISAIVAKKLTDSIPVAIAGIPGGVMSAPMVEHAMVLKK… |
| Q6LNJ8 | 2-288 | LDGILSGLSTAIMPTNLMMVMVGCFVGTFIGMLPGLGPISAIALMIPISYGLDPASGLILMAGVYYGAVFGGSTSSILINAPGCSST… |
| A0A2E3QLX5 | 2-347 | None |
| A0A812T3Q8 | 791-1081 | None |
| A0A1Y5SHZ1 | 46-324 | None |
| A0A395YH52 | 15-312 | None |
| A0A4Y9VC92 | 739-1069 | None |
| A0A0J9EBS4 | 6-329 | None |
| A0A1Z2SKD8 | 2-337 | None |
| A0A843JC95 | 8-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.