DPCstruct | MC18296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9ALZ0 | 5-131 | QQSLETLENHISPAPEDSSYLVQTCHSLRKKPLADFEVEDLRIMIGQNIGLKWLMPLAIQVLQQNILAEGHFYRGDLLQAVLTSEKS… |
| A0A4Z0VBQ8 | 2-139 | KNEILNKSLLELGEWTWLRQPSGDDLQSDRLTMELDCLSKKKLCDYSNSDIYLAVSQEKGLRFTLPLAIRLIEDDILIECEFYEGDL… |
| A0A2R4M0V5 | 17-146 | None |
| A0A387H3J3 | 1-99 | None |
| A0A2P8C5D3 | 23-142 | None |
| G8R0V9 | 3-114 | None |
| A0A1M3CPL7 | 1-129 | None |
| A0A0N7LY91 | 1-118 | None |
| A0A1H8B717 | 10-150 | None |
| A0A1I0AM43 | 26-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.