DPCstruct | MC18293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 193 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9VX79 | 3-195 | KEYEALITKLLIEIENSPKGELERPQRTRLWAMITENKNTTEQKQLLTKLNIACVQHGIGFWTKKFGDDQRIKHVLTVALQAADGAF… |
| A0A4Z0V396 | 7-188 | IKSLIRKGLDEVNHSSAGHLSLSTRRKILQAINEPCIIGRISILCALKVYPIWNDLFRDDTDIIGLITKTEKYLLGQTSKKDLLKDA… |
| A0A1I1DHM4 | 223-433 | None |
| A0A6H0KNJ5 | 8-190 | None |
| A0A4R1Q1K7 | 33-268 | None |
| A0A3A8NMZ1 | 10-178 | None |
| D4V6E6 | 2-194 | None |
| A0A413H0L3 | 5-187 | None |
| I7CJ05 | 80-280 | None |
| A0A520R7U4 | 243-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.