DPCstruct | MC18290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267G2P5 | 180-252 | LAVFANSIPEIADILSSRNKYGGHFHKEAGKQHIVLCGHITYESVSNFLGDFLHEDREDVDVQIVILDKHVPD |
| A0A060YCH0 | 1-67 | MFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHK |
| A0A183SKP5 | 176-248 | None |
| T1F8C9 | 10-91 | None |
| A0A5J5CSH7 | 195-270 | None |
| T1ENA6 | 2-76 | None |
| A0A0L7QPN4 | 106-170 | None |
| A0A7R9IAC5 | 95-168 | None |
| A0A816BMC3 | 288-370 | None |
| A0A820V1Q0 | 303-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.