DPCstruct | MC1829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF06793- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4YW22 | 18-126 | AVGPFKLVLDIKRGKLIFDIRDENDAPIMLHILSLSPFRLIMKDYFLICERHHEAVKSANPQQIEAIDMGRRGLHNEGSELLSDRLK… |
| A0A2G6J504 | 14-142 | SNEAREREWELALADLNADCDGGLPTLTFERRRDGGADIVVAGPAGAAPARVSFPYARLRSQLREYRDVIGKMARADGGWAGSRDFD… |
| A0A6A5LAK2 | 539-684 | None |
| A0A178XX01 | 1-134 | None |
| A0A4S5IZC4 | 8-153 | None |
| A0A6N2D555 | 85-218 | None |
| A0A5R9J3S6 | 44-177 | None |
| A0A1J5NWD4 | 3-110 | None |
| K2GQQ1 | 5-151 | None |
| A0A6L7XFG3 | 21-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.