DPCstruct | MC18286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 58.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060Y6H6 | 2-72 | DELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQMVSMGSESECSPLFTLT |
| A0A060XU99 | 1-58 | MDELRHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSSFFQEANIPSHHHQMVSA |
| A0A0N4U529 | 8-96 | None |
| A0A1A6H4Z5 | 99-173 | None |
| A0A811Z1G5 | 55-132 | None |
| A0A151N3P4 | 5-80 | None |
| A0A816N252 | 6-96 | None |
| A0A3Q1MKT9 | 5-70 | None |
| A0A3B3QLG9 | 66-141 | None |
| A0A7J8J419 | 5-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.