DPCstruct | MC18285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 186 ± 38 aa |
| Standard deviation of domain lengths | 37.92 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09753 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6G813 | 1-134 | MAASRLELNLVRLLCRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKAQASKPTSEVIGEYSRKVDFLKGMLQAEKLTSSAEKALAN… |
| A0A060Y3T4 | 2-198 | ASSRLEINFIRLLSRCESIASEKRVETEWRLEKYVGALEEMLVALRKSPSKPTVEVMTDYTRKVDFLKGLLEAEKLSGTEKALANQF… |
| A0A2H5R422 | 1-249 | None |
| A0A1I7W7P4 | 1-154 | None |
| T1FME0 | 4-212 | None |
| A0A2G8LA74 | 4-177 | None |
| A0A1I8I1L2 | 1-239 | None |
| A0A7E5WPT2 | 7-228 | None |
| A0A2R2MQA7 | 2-157 | None |
| A0A4W3GW76 | 61-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.