DPCstruct | MC18284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 212 ± 31 aa |
| Standard deviation of domain lengths | 31.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060Y3S8 | 25-218 | VGQANRQVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGNPVERTGVKMRGPPGEQLSFASGLVYSLTL… |
| A0A0L8GW94 | 8-199 | VAQANVHVSLLQSFMPDTFLKTGDSDAILAVLLVPRAISKAELLISHVRDKFDVTDTITRDDVFKTHRGAQVSYANNLIMLLNILIG… |
| A0A5K3EUN9 | 147-415 | None |
| A0A5K3ESM0 | 147-415 | None |
| K1PZ33 | 23-207 | None |
| A0A0D8XKL2 | 31-262 | None |
| A0A820CBN0 | 101-327 | None |
| A0A817PAU5 | 2-193 | None |
| A0A4U5MHV6 | 346-580 | None |
| A0A816H7T8 | 118-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.