DPCstruct | MC18281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 197 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NRD7 | 101-299 | KYIRSIVCESTTKLLIHLVSMMQACTDQSGPLVGKHLPENVLSKIPKEWNYIPKDPKFNEPSKNSTNLVIQALSFIFTHLPSTIASL… |
| A0A060Y1D3 | 1-185 | MVLAWQASEDPCSSLLRRDIPDNILTKVPREWSYTLQTPKGRESAKSVVNLALQALSFIYTNLPSAVASLPLPVRFLFHTAEKHLSQ… |
| A0A7J7XZA4 | 264-471 | None |
| A0A1L8I1Q9 | 885-1088 | None |
| A0A1A7Y376 | 355-559 | None |
| A0A3P9C8Y7 | 496-701 | None |
| A0A2U3X426 | 142-344 | None |
| A0A3Q1AJ25 | 17-182 | None |
| Q4SG32 | 2-197 | None |
| A0A4Z2EW10 | 10-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.