DPCstruct | MC18278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 403 ± 43 aa |
| Standard deviation of domain lengths | 42.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4URK5 | 1-330 | MQEQGGGRNLAIQPTIPHIPIGQQLISPHMHPAQPPPASQSNISSIHSSPIIQTPTQPTTHTQTNQQTQQTGQLSVRRTYSRRFLFL… |
| A0A060XZH9 | 19-368 | QLIEEDSDPMLSPRFHAYGHCQQYIDDTEVPPSPPNTHSFASRRRSSSLGSCGDDDQQELTSAQLSKKIHGLKRKIHKYEEKFEEER… |
| A0A131XCE2 | 494-910 | None |
| A0A4P9WI43 | 29-451 | None |
| U6L068 | 249-725 | None |
| A0A1A9ZYH6 | 299-756 | None |
| A0A3B5R0C5 | 15-424 | None |
| A0A7R9AHG1 | 60-450 | None |
| A0A1L8HMC9 | 198-600 | None |
| A0A7E4RT80 | 386-766 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.