DPCstruct | MC18277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 13.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XZD3 | 1-180 | MYFSSSCAPFGYEFLYSSHHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSCSQDRDTQKIQWIDRFIEELRTNDKWVIPALKQ… |
| A0A183E859 | 183-308 | GSLTLKSLSLLWDLFRDDRLPVEMVDAALDAHFSVLENAVPAEEVRRHYIERCIDELLIDSVFVLPTLKHMQRLMMLVPENDFCYGK… |
| A0A818CFT4 | 541-682 | None |
| J9F3Y0 | 431-563 | None |
| A0A821IRV0 | 76-210 | None |
| A0A2K6R1G4 | 1-131 | None |
| A0A820GB21 | 1-138 | None |
| A0A3Q0IN32 | 216-354 | None |
| A0A822B400 | 2-126 | None |
| A0A1S3GVN4 | 58-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.