DPCstruct | MC18273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 182 ± 35 aa |
| Standard deviation of domain lengths | 34.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4ED67 | 1-152 | MEAYLIKTLVSFSTDFSEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIDI… |
| A0A060XYJ9 | 1-218 | MVGFIREEFEDKGHIDCTAVYFSFIKSLVFFCMMPSTFSLILYKQKGHAVIYLNHLLTDMGEVYHLLSNMVKDTGSETYFLSILQHL… |
| A0A0D8XDE6 | 606-769 | None |
| A0A671NAX8 | 239-403 | None |
| A0A0N1IQ25 | 563-772 | None |
| T1KRW8 | 307-484 | None |
| H3B7I1 | 194-363 | None |
| S9YBJ0 | 9-219 | None |
| A0A4Z2H534 | 2-127 | None |
| A0A183HI29 | 1-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.