DPCstruct | MC18272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 199 ± 26 aa |
| Standard deviation of domain lengths | 26.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XXF2 | 5-164 | NPGEETIETLVKTQDERYIDRGVRTYTWAQVNGTDYRLALALPMYSEHYIQAKLGDTIRQAMAMDTLQVERFDELGHTFIVPREYCK… |
| A0A8B6GHT8 | 90-307 | RGESGKKTLPNVYFTLPRGRLVNEGSRYLQYQATFFWGPVQNTRFYLCIVLREETHTVISEADFDISNSEMNNVFLYHNRSLTSDSQ… |
| A0A016U773 | 283-462 | None |
| A0A5E4Q8I4 | 7-202 | None |
| A0A0D8XDK1 | 31-194 | None |
| D2GWZ0 | 367-584 | None |
| A0A6V7X0V8 | 203-389 | None |
| A0A4Z2J1Z4 | 1-218 | None |
| A0A164SLC4 | 760-957 | None |
| A0A811V314 | 410-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.