DPCstruct | MC18271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0TYB4 | 1-116 | MAQDTAVPKLDFVYWLDKAIKWSQATTLESQKDVCLHLPQLQEFLHQVYETLKHMDSIVAIQQFPLIGQLLGRLCWNPFVMGYDESQ… |
| A0A060XWU6 | 48-161 | TGSMAGLKPQEVAFWLGKAVEWGQTESPDTQRDTCLHLGPLRAFLQLLLTDIHMRSSTTETMRTIPFVGQFLGRLCWNPYVTADAES… |
| A0A1S3PFY9 | 5-125 | None |
| A0A6I9N6M0 | 3-133 | None |
| A0A3Q3B4G3 | 1-125 | None |
| M7BQ68 | 1-127 | None |
| A0A5N3VTT0 | 1-113 | None |
| A0A4Z2HLE9 | 3-129 | None |
| A0A1Y7VKS5 | 10-119 | None |
| A0A2K5I0L9 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.