DPCstruct | MC1827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 67 ± 14 aa |
| Standard deviation of domain lengths | 14.15 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.60 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0167- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257WKZ4 | 13-71 | VRVPGKFIPDPLSVMTTGAPFCPLCQTRMVRRKARHGANSGKEFWGCSRYPDCTGKRPA |
| A0A3C1LL51 | 42-82 | KRDCPKCGSPMVIRLSKRGVDPGRYFWGCSNYPECKVTFTI |
| A0A0P9NK42 | 126-199 | None |
| A0A7W1K0T1 | 26-92 | None |
| A0A832J156 | 143-186 | None |
| A0A7X7G2Z7 | 2-74 | None |
| A0A7X7U581 | 93-165 | None |
| A0A520W513 | 2-43 | None |
| A0LD91 | 179-247 | None |
| A0A290WVD3 | 62-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.