DPCstruct | MC18267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 321 ± 63 aa |
| Standard deviation of domain lengths | 63.17 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SPZ4 | 2-207 | IESSLAGEASLVVLDILELLIGNTLHIENLQSVLGKNLEVLLHLMLCNQSIEVSRCVFASQRAIVRKFPELILYEETEQCAELCARL… |
| A0A060XUL7 | 18-325 | IRTSSISFRTCLVQFRYVGKRNIGRSQDAWVSKLFSSDRKSQTMPVMRCRAGLMQSRLQQFSTMDTSLTLNIGAGPSEAEVHHQALL… |
| A0A060WPH1 | 155-512 | None |
| A0A6G0HI57 | 698-986 | None |
| Q8SAB7 | 1013-1416 | None |
| B7P6N2 | 1-453 | None |
| A0A1X7SYM2 | 336-624 | None |
| F1QAS2 | 5-343 | None |
| A0A7D9LLC3 | 227-502 | None |
| S4RAV1 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.