DPCstruct | MC18265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 282 ± 19 aa |
| Standard deviation of domain lengths | 18.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9YGY4 | 1-292 | MLKRIQLEPWTAFDKHCLTSAVSRVGDQNWTAVSRATRNIYEDSSKWISGGEKRSVEWFSNKQCAAQYEHLLKNVPPRRKKRSERTS… |
| E2A4Q9 | 14-299 | NCDAWTTREQLCLASSVLKSGDQNWMSVSRSLKPLIEKESLRPPDWFSQKSCAMQYAYLLENADTPKRKKRESGETTSESIVRRLTQ… |
| A0A6F8ZYM1 | 1-300 | None |
| A0A3Q0IRE8 | 18-303 | None |
| A0A0P7VGW7 | 1-297 | None |
| A0A803R7A6 | 1-243 | None |
| A0A2G8KLF5 | 3-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.