DPCstruct | MC1826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 210 ± 21 aa |
| Standard deviation of domain lengths | 20.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3BBS9 | 224-427 | EPYPMRDAVQHFCEKHNDKIKTYMQKVLVKIPLPVKCTIEEKRSKKIAKIYFACQAKGEHCLYTRNYFVMKTKNARVWIHLMFLALQ… |
| A0A183J5N9 | 1-247 | HECAVKGDAVRQFCEKHYQKIKNYIADLNTKYPVPCQCTVEESGNKQIVRIHFACQDRSDLCLYTSTCFAFKTKIPHLWLHLMFLHL… |
| S4RMM0 | 234-449 | None |
| A0A4U8UPR7 | 863-1080 | None |
| A0A6H5HNA3 | 482-690 | None |
| A0A813UCJ5 | 587-834 | None |
| A0A2A2KSR0 | 292-502 | None |
| A0A7R9U324 | 198-392 | None |
| A0A6L5CS83 | 1-214 | None |
| A0A2G9UQZ9 | 105-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.