DPCstruct | MC18258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0028- PF18117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1QZG4 | 8-123 | ETSSFETSEVLATCLASTPLLSESWRLCSVANDTAPWSFVTEQGGGGGGVTYVAFSSAQMMASGWECSWRNMIPLESMGELPLFWWH… |
| A0A6A2WRR4 | 1-106 | MSETLATFLASTPLLEEAWRVCSIANTSFPGAYLVQQIGSVAYIAFSGIQMSAGSDQNCRNLVALDAEDGGLFAPLYRHSEAEEPIK… |
| A0A5A7P0G0 | 97-216 | None |
| A0A2P5WUK9 | 2-103 | None |
| A0A0L9UDL2 | 5-116 | None |
| A0A072TT99 | 1-123 | None |
| A0A5N5FKX3 | 1-124 | None |
| B9SAA5 | 2-135 | None |
| A0A3P6CV06 | 1-119 | None |
| A0A7C9ALU1 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.